PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009627993.1
Common NameAn2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 220aa    MW: 25477 Da    PI: 9.9243
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009627993.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd ll+++++++G g W+ ++ + g++R++k+c++rw++yl
   XP_009627993.1 14 KGAWTEEEDVLLKKCIEKYGEGKWHQVPLRAGLNRCRKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.86.7e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg ++ +E +l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
   XP_009627993.1  67 RGDFSFDEVDLILRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-23964IPR009057Homeodomain-like
PROSITE profilePS5129425.149965IPR017930Myb domain
SuperFamilySSF466893.26E-2911108IPR009057Homeodomain-like
SMARTSM007171.6E-151363IPR001005SANT/Myb domain
PfamPF002494.9E-161461IPR001005SANT/Myb domain
CDDcd001676.92E-111661No hitNo description
Gene3DG3DSA:1.10.10.603.3E-2365117IPR009057Homeodomain-like
PROSITE profilePS5129419.64366116IPR017930Myb domain
SMARTSM007174.8E-1566114IPR001005SANT/Myb domain
PfamPF002491.0E-1367112IPR001005SANT/Myb domain
CDDcd001671.08E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MNICTNKSSS GVKKGAWTEE EDVLLKKCIE KYGEGKWHQV PLRAGLNRCR KSCRLRWLNY  60
LRPHIKRGDF SFDEVDLILR LHKLLGNRWS LIAGRLPGRT ANDVKNYWNS HLRKKLIAPH  120
DQKESKQKAK KITIFRPRPR TFSKTNTCVK SNTNTVDKDI EGSSEIIRFN DNLKPTTEEL  180
TDDGIQWWAD LLANNYNNNG IEEADNSSPT LLHEEMPLFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-23141164105MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-231411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-231411658159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-23141164105C-Myb DNA-Binding Domain
1msf_C2e-23141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00213DAPTransfer from AT1G66370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ4726470.0FJ472647.1 Nicotiana tabacum cultivar SamsunNN anthocyanin 2 (An2) mRNA, complete cds.
GenBankFJ4726480.0FJ472648.1 Nicotiana tomentosiformis anthocyanin 2 (An2) mRNA, complete cds.
GenBankFJ4726500.0FJ472650.1 Nicotiana tabacum cultivar SamsunNN anthocyanin 2 (An2) gene, complete cds.
GenBankFJ4726510.0FJ472651.1 Nicotiana tomentosiformis anthocyanin 2 (An2) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009627993.11e-163PREDICTED: transcription factor MYB114-like
RefseqXP_016468884.11e-163PREDICTED: transcription factor MYB114-like
SwissprotQ9FNV91e-69MY113_ARATH; Transcription factor MYB113
TrEMBLC1JAC91e-162C1JAC9_TOBAC; Anthocyanin 2
TrEMBLC1JAD01e-162C1JAD0_NICTO; Anthocyanin 2
STRINGSolyc10g086250.1.16e-77(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.17e-71myb domain protein 113